Cat: PA1000-2291

Recombinant Human PBLD Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PBLD

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PBLD;MAWBP;Phenazine biosynthesis-like domain-containing Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P30039

  • Expression Region

    1-288aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMKLPIFIADAFTARAFRGNPAAVCLLENEL DEDMHQKIAREMNLSETAFIRKLHPTDNFAQSSCFGLRWFTPASEVPLCG HATLASAAVLFHKIKNMNSTLTFVTLSGELRARRAEDGIVLDLPLYPAHP QDFHEVEDLIKTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVN TENLLQVENTGKVKGLILTLKGEPGGQTQAFDFYSRYFAPWVGVAEDPVT GSAHAVLSSYWSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAV VLEGTLTA

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PBLD (Protein-Binding Lipocalin Domain) is an intriguing protein that has garnered significant attention due to its diverse biological roles and potential implications in various diseases. Discovered in the context of kidney health, PBLD is implicated in the transport and binding of small hydrophobic molecules, such as fatty acids and hormones, thereby influencing metabolic and physiological processes. With its lipocalin structure, PBLD exhibits unique features that allow it to interact with multiple ligands, making it a critical player in lipid metabolism and signaling pathways. Research has indicated that dysregulation of PBLD may contribute to pathological conditions, including obesity, diabetes, and cardiovascular diseases. Recent studies employing molecular biology techniques have aimed to elucidate the precise mechanisms by which PBLD operates within cellular environments, providing insights into its functional roles and potential therapeutic applications. Understanding the nuances of PBLD activity and its interactions with various biomolecules could pave the way for novel strategies in disease prevention and management, highlighting the importance of ongoing research in this promising area of protein science.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US