Analytical Data
-
Gene name
csn
- Application
-
Alternative Names
csn；MYEOV2；COP9 signalosome complex subunit 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
S6FZ94
-
Expression Region
37-278aa
-
AA Sequence
AGLNKDQKRRAEQLTSIFENGKTEIQYGYVEALDDGRGYTCGRAGFTTATGDALEVVEVYTKAVPNNKLKKYLPELRRLAKDESDDISNLKGFASAWRSLGNDKAFRAAQDKVNDSLYYQPAMKRSENAGLKTALAKAVMYDTVIQHGDGDDPDSFYALIKRTNKKMGGSPKDGTDEKKWLNKFLDVRYDDLMNPSDEDTQDEWRESVARVDVFRDIVKEKNYNLNGPIHVRSSEYGNFTIQ
-
Molecular Weight
31.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Csn (Cop9 signalosome) is a multi-subunit protein complex that plays a crucial role in various cellular processes, including regulating protein degradation, cell cycle progression, and stress responses. This complex is evolutionarily conserved across eukaryotes and is known for its involvement in the modification of ubiquitin-proteasome pathways, particularly by processing and stabilizing key regulatory proteins. Recent studies have highlighted the significance of Csn in numerous biological contexts, such as development, immune responses, and tumorigenesis. The interest in Csn reorganization arises from its potential as a therapeutic target, especially in cancer, where aberrant signaling pathways often involve faulty protein degradation mechanisms. Researchers are increasingly focused on elucidating the structural and functional dynamics of Csn to better understand how its reorganization can influence cellular signaling pathways. Understanding the intricacies of Csn's role in protein homeostasis and its interactions with various substrates could pave the way for novel strategies to manipulate these pathways in disease contexts.
