Analytical Data
-
Gene name
tusA
- Application
-
Alternative Names
tusA；sirA；yhhP；Sulfur carrier Protein TusA
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9I3F3
-
Expression Region
1-79aa
-
AA Sequence
MTHSVDAILDATGLNCPEPVMMLHNKVRDLAPGGLLKVIATDPSTRRDIPKFCVFLGHELVEQQEEAGTYLYWIRKKAD
-
Molecular Weight
16.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of tusA recombinant protein has gained significant interest in recent years due to its potential applications in molecular biology and biotechnology. TusA, a protein derived from certain bacterial species, plays a critical role in DNA replication and regulation. Its unique properties make it a valuable tool for understanding the mechanisms of DNA replication, as well as for developing novel biotechnological applications. Researchers have focused on the expression and purification of tusA in various host systems to explore its structural and functional characteristics. Recombinant tusA protein can serve as a model for studying protein-DNA interactions, as it has been shown to bind specifically to certain DNA sequences, thereby influencing replication processes. Additionally, the ability to manipulate tusA through genetic engineering opens avenues for designing tailored proteins with enhanced functionalities, such as in gene therapy, synthetic biology, and the development of new therapeutic agents. Overall, the research on tusA recombinant protein holds promise for advancing our knowledge of molecular genetics and expanding the toolkit for biotechnological innovations.
