Analytical Data
-
Gene name
GHRHR
- Application
-
Alternative Names
GHRHR；Growth hormone-releasing hormone receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q02643
-
Expression Region
23-132aa
-
AA Sequence
HMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGE WVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEE ESYFSTVKII
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GHRHR, or Growth Hormone-Releasing Hormone Receptor, plays a crucial role in the endocrine system by mediating the effects of growth hormone-releasing hormone (GHRH) on growth hormone (GH) secretion from the pituitary gland. Dysregulation of the GHRHR signaling pathway is implicated in various growth disorders, obesity, and metabolic syndromes, making it a significant target for research. The study of GHRHR recombinant proteins has gained attention as these proteins can be used for understanding receptor-ligand interactions, signaling mechanisms, and developing potential therapeutic agents. The generation of recombinant GHRHR offers insights into the receptor's structure-function relationships and aids in the discovery of small molecule agonists or antagonists that could modulate its activity. Additionally, these studies can elucidate the receptor's role in physiological processes and its implications in disease states. As a result, research on GHRHR recombinant proteins holds promise for advancing our knowledge of growth regulation and addressing related health issues.
