Cat: PA1000-2275

Recombinant Human PAFAH2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PAFAH2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PAFAH2;Platelet-activating factor acetylhydrolase 2. cytoplasmic

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99487

  • Expression Region

    1-392aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMGVNQSVGFPPVTGPHLVGCGDVMEGQ NLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNKRCGGLLF NLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASR GFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKE FHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDM SRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPV FFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNL IGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGI GPSLTPGAPHHLSSL

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PAFAH2, also known as phospholipase A2 family member 2, is an enzyme that plays a significant role in lipid metabolism and inflammation regulation. Given its involvement in the hydrolysis of phospholipids, PAFAH2 has garnered attention for its potential implications in various pathological conditions, including cardiovascular diseases and cancer. Research has shown that dysregulation of phospholipid metabolism can contribute to the progression of these diseases, which underscores the importance of understanding PAFAH2's structure, function, and regulatory mechanisms. Recent studies have focused on the recombinant expression of PAFAH2 to facilitate detailed biochemical characterization and functional assays. By producing PAFAH2 as a recombinant protein, researchers aim to investigate its enzymatic properties, interactions with other cellular components, and its role in mediating inflammatory responses. The recombinant approach allows for the production of large quantities of pure enzyme, enabling in vitro studies to elucidate its substrate specificity and inhibition mechanisms. Furthermore, exploring the potential of PAFAH2 as a therapeutic target may open new avenues for treating diseases associated with lipid dysregulation. Overall, advances in the recombinant technology surrounding PAFAH2 could provide critical insights into its biological functions and therapeutic applications, highlighting its relevance in the growing field of lipidomics and disease modulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US