Analytical Data
-
Gene name
MAN2A1
- Application
-
Alternative Names
3-1; 6-alpha-mannosidase; Alpha mannosidase 2; alpha Mannosidase II; Alpha-mannosidase 2; AMAN II; Golgi alpha mannosidase II; Golgi alpha-mannosidase II; Golgi integral membrane protein 7; GOLIM7; MA2A1_HUMAN; MAN II; Man2a1; MANA 2; MANA2; MANII; Mann II; Mannosidase alpha class 2A member 1; Mannosidase Two; Mannosidase; alpha type II
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16706
-
Expression Region
1045-1144aa
-
AA Sequence
DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAN2A1 (Mannosidase Alpha Class 2A Member 1) is an important enzyme involved in the degradation of glycoproteins, playing a crucial role in glycan processing and protein homeostasis within cellular environments. This enzyme is primarily localized in the endoplasmic reticulum and is responsible for catalyzing the hydrolysis of mannose residues from high-mannose N-glycans. Dysfunctional MAN2A1 has been implicated in various diseases, including glycosylation disorders and certain types of cancer, making it a potential target for therapeutic intervention. The production of recombinant MAN2A1 protein has become a pivotal area of research to better understand its structure-function relationships, enzymatic mechanisms, and potential applications in biotechnology. By harnessing techniques in recombinant DNA technology and expression systems, researchers aim to produce active MAN2A1 for biochemical assays, structural studies, and explorations of its role in cellular processes. Furthermore, understanding the regulation and activity of MAN2A1 could provide insights into novel strategies for the treatment of diseases related to protein misfolding and glycan dysregulation. Therefore, the investigation of MAN2A1 recombinant protein not only advances fundamental scientific knowledge but also holds promise for innovative therapeutic approaches in medicine.
