Cat: PA2000-4982

Recombinant Human nad2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    nad2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    nad2;APOBEC3DE;DNA dC->dU-editing enzyme APOBEC-3D

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A0A075XDS2

  • Expression Region

    32-300aa

  • AA Sequence

    GMMSKELKKNSMTSSPSMFYLLVQLPASIIFLIFMTSNPNSKTIMCMGILVMMIKSGAFPFHMWYLKTLGLLNMSSPSMKMIMTWQKIIPFFILSYFKLWELLVILGLMNMLIPLVKMSKLSSMKSILVLSSINNNSWFMMSSLLSFMILSLYFMIYSLSLLITMSFLKSVKKKSFILKENPMETMLVIMNLGGIPPSVMFLGKMIIFTLLVKMNLPKEIMMLMLMMACYFMYHYLWCTFPYLMNTPLKSQNQVMNKNTTFMLTLMMLL

  • Molecular Weight

    32.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NAD2 recombinase, a critical enzyme involved in the maintenance of mitochondrial DNA, has garnered attention due to its pivotal role in the process of mitochondrial recombination and repair. Mitochondria, the powerhouse of the cell, contain their own circular DNA, which is essential for cellular energy production. However, this mitochondrial DNA is prone to mutations and damage, leading to various metabolic disorders and degenerative diseases. Research into NAD2 recombinase has primarily focused on understanding its molecular mechanisms and functions in promoting homologous recombination, thereby safeguarding mitochondrial integrity. Additionally, the enzyme's role in the repair of DNA double-strand breaks, which can have catastrophic effects on cellular function, is a critical area of study. With the potential implications in aging, cancer, and mitochondrial diseases, elucidating the functions and regulatory mechanisms of NAD2 recombinase could lead to novel therapeutic strategies aimed at enhancing mitochondrial function and preventing disease progression. Studies have investigated the interactions of NAD2 with other mitochondrial proteins and its influence on the mitochondrial genome's stability, contributing to a broader understanding of mitochondrial biology and its impact on human health. As researchers continue to explore the complexities of this enzyme, the insights gained may pave the way for innovative interventions in the treatment of mitochondrial-related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US