Analytical Data
-
Gene name
nad2
- Application
-
Alternative Names
nad2;APOBEC3DE;DNA dC->dU-editing enzyme APOBEC-3D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A075XDS2
-
Expression Region
32-300aa
-
AA Sequence
GMMSKELKKNSMTSSPSMFYLLVQLPASIIFLIFMTSNPNSKTIMCMGILVMMIKSGAFPFHMWYLKTLGLLNMSSPSMKMIMTWQKIIPFFILSYFKLWELLVILGLMNMLIPLVKMSKLSSMKSILVLSSINNNSWFMMSSLLSFMILSLYFMIYSLSLLITMSFLKSVKKKSFILKENPMETMLVIMNLGGIPPSVMFLGKMIIFTLLVKMNLPKEIMMLMLMMACYFMYHYLWCTFPYLMNTPLKSQNQVMNKNTTFMLTLMMLL
-
Molecular Weight
32.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NAD2 recombinase, a critical enzyme involved in the maintenance of mitochondrial DNA, has garnered attention due to its pivotal role in the process of mitochondrial recombination and repair. Mitochondria, the powerhouse of the cell, contain their own circular DNA, which is essential for cellular energy production. However, this mitochondrial DNA is prone to mutations and damage, leading to various metabolic disorders and degenerative diseases. Research into NAD2 recombinase has primarily focused on understanding its molecular mechanisms and functions in promoting homologous recombination, thereby safeguarding mitochondrial integrity. Additionally, the enzyme's role in the repair of DNA double-strand breaks, which can have catastrophic effects on cellular function, is a critical area of study. With the potential implications in aging, cancer, and mitochondrial diseases, elucidating the functions and regulatory mechanisms of NAD2 recombinase could lead to novel therapeutic strategies aimed at enhancing mitochondrial function and preventing disease progression. Studies have investigated the interactions of NAD2 with other mitochondrial proteins and its influence on the mitochondrial genome's stability, contributing to a broader understanding of mitochondrial biology and its impact on human health. As researchers continue to explore the complexities of this enzyme, the insights gained may pave the way for innovative interventions in the treatment of mitochondrial-related conditions.











