Cat: PA1000-2239

Recombinant Human OGG1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OGG1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OGG1;MMH;MUTM;OGH1;N-glycosylase/DNA lyase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15527

  • Expression Region

    1-345aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHTGSMPARALLPRRMGHRTLASTPALWASIP CPRSELRLDLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTEEQLHCTV YRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHFQEVAQKF QGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVT YHGFPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQ LRESSYEEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQR DYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADLRQCR HAQEPPAKRRKGSKGPEG

  • Molecular Weight

    41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OGG1 (8-oxoguanine DNA glycosylase 1) is a critical enzyme involved in the base excision repair pathway, playing a pivotal role in maintaining genomic stability by recognizing and excising 8-oxo-7,8-dihydroguanine (8-oxoguanine), a common oxidative DNA lesion. The accumulation of such oxidative damage is associated with various pathological conditions, including cancer, neurodegenerative diseases, and aging. Understanding OGG1 function and regulation has garnered significant attention in recent years, as it serves as a key player in protecting cells from the deleterious effects of reactive oxygen species. Research has shown that polymorphisms in the OGG1 gene can influence an individual's susceptibility to oxidative stress-related diseases, making it a crucial focus for genetic and epidemiological studies. Additionally, the exploration of OGG1's interactions with other repair proteins and its potential post-translational modifications is essential for elucidating the broader mechanisms of DNA repair and cellular response to oxidative damage. Thus, ongoing investigations into OGG1 not only enhance our comprehension of cellular defense mechanisms but also hold promise for therapeutic interventions aimed at modulating its activity in disease contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US