Analytical Data
-
Gene name
IFNt
- Application
-
Alternative Names
IFNt；IFN；Interferon tau
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28172
-
Expression Region
1-195aa
-
AA Sequence
MAFVLSLRMALVLVSYCPGGSLGCYLSRRPTLDVRENLRLLDRMNRLSPHSCQQDRKDFGLPQEMVEGDQLQKDQALSVLYEMLQQRFNLFHTEHSCAAWNTTLLEQLRTGLHQQLEDLDTCRGPVMGEKDSELGKMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTSSTTLQKRLKKTGGDLNSP
-
Molecular Weight
22.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interferon Tau (IFNt) is a type I interferon predominantly produced by the trophectoderm of ruminant embryos during early pregnancy. Its primary role is to signal maternal recognition of pregnancy, ensuring that the maternal immune system does not reject the developing embryo. Research on IFNt has gained significant attention due to its potential applications in reproductive biotechnology and veterinary medicine. Scientists have been particularly focused on the recombinant production of IFNt, as it allows for the study of its biological functions and mechanisms in a controlled environment. This recombinant protein can be utilized in various experimental settings to investigate its effects on immune modulation, cell signaling pathways, and its role in sustaining early pregnancy. Additionally, advances in cloning and protein engineering techniques have facilitated the development of optimized IFNt variants with enhanced biological activity. These studies not only deepen our understanding of early gestation in ruminants but also open doors for innovative approaches in fertility treatments and hormonal therapies in livestock and possibly in human medicine. The ongoing research aims to elucidate the multifaceted roles of IFNt in reproductive health, paving the way for developing novel reproductive technologies and improving reproductive outcomes in both agricultural and clinical settings.
