Analytical Data
-
Gene name
Prok2
- Application
-
Alternative Names
Prok2；BV8；Prokineticin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HC23
-
Expression Region
1-129aa
-
AA Sequence
MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
-
Molecular Weight
14.3kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Prokineticin 2 (Prok2) is a crucial regulatory protein involved in various physiological processes, including reproductive functions and circadian rhythm regulation. It is a member of the prokineticin family, which plays significant roles in neuroendocrine signaling and the modulation of neuronal activity. The significance of Prok2 is underscored by its involvement in the signaling pathways of the central nervous system, particularly through its receptor, PKR2, which influences neuronal development and function. Research on recombinant Prok2 proteins has gained momentum as scientists aim to elucidate the molecular mechanisms behind its actions and identify potential therapeutic targets for diseases linked to its dysregulation, such as infertility and sleep disorders. Advances in recombinant DNA technology have facilitated the production of high-purity Prok2, enabling in-depth studies of its structure-function relationships and interactions with receptors. Furthermore, understanding the role of Prok2 in various pathological conditions could lead to the development of novel pharmacological agents, enhancing treatment options for related disorders. Overall, the research on recombinant Prok2 proteins is pivotal in bridging gaps in our understanding of neuroendocrine regulation and its implications for human health.
