Analytical Data
-
Gene name
MAC30
- Application
-
Alternative Names
TMEM97; MAC30; S2R; Sigma intracellular receptor 2; Sigma-2 receptor; Sigma2 receptor; Meningioma-associated protein 30; Transmembrane protein 97
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5BJF2
-
Expression Region
1-69aa
-
AA Sequence
MTTLIPILSTFLFEDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
-
Molecular Weight
34.6 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAC30, also known as MGC-30, is a member of the macrophage expressed protein family that has garnered attention in recent years due to its potential role in immune response and cell signaling. Initially discovered in the context of macrophage activation, MAC30 is believed to participate in various cellular processes, including inflammation, pathogen recognition, and apoptosis. Research indicates that MAC30 may play a crucial role in modulating immune responses, particularly in the context of chronic diseases and infections. The protein has been implicated in pathways associated with cytokine production and antigen presentation, suggesting its involvement in the body’s defense mechanisms. Additionally, studies have shown that MAC30 can influence the proliferation and differentiation of certain immune cells, further underscoring its importance in maintaining immune homeostasis. Given its emerging role in immunobiology, MAC30 is being investigated for its therapeutic potential in treating immune-related disorders, such as autoimmune diseases and cancers. Understanding the structure-function relationship of MAC30 and its interactions with other cellular pathways may provide valuable insights into developing novel interventions aimed at enhancing immune responses or mitigating excessive inflammation. Overall, ongoing research on MAC30 is essential for elucidating its biological functions and harnessing its potential in clinical applications.
