Analytical Data
-
Gene name
NXT1
- Application
-
Alternative Names
NXT1;NTF2-related export Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UKK6
-
Expression Region
1-160aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMASVDFKTYVDQACRAAEEFVNVYYTTMDK RRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPV HDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIAS DCFRFQDWAS
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NXT1, or nuclear export factor 1, is a crucial protein involved in the nuclear export of RNA and ribonucleoprotein complexes. Its significance has risen in the context of various cellular processes, including gene expression regulation and response to stress. Research into NXT1 has gained momentum due to its potential implications in disease mechanisms, particularly in cancer and viral infections where the hijacking of host cellular machinery plays a pivotal role. Understanding the structure and function of NXT1, especially in its role as part of the nuclear export pathway, can illuminate pathways that influence cellular homeostasis and pathology. Recent studies have focused on the recombinant expression of NXT1 to facilitate detailed biophysical and biochemical characterization, opening avenues for therapeutic targeting. By utilizing recombinant technology, researchers can obtain purified NXT1 for studies examining its interactions with RNA, other nuclear export factors, and various viral proteins. This enhances our understanding of its functional dynamics and potential as a drug target, contributing to the broader field of molecular biology and therapeutic development. Furthermore, dissecting NXT1's role in the context of specific diseases may reveal novel biomarkers or therapeutic strategies, highlighting its relevance in both fundamental research and clinical applications.
