Cat: PA2000-691DB

Recombinant Human PITPNb Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PITPNb

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PITPNb;Phosphatidylinositol transfer Protein beta isoform

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P48739

  • Expression Region

    1-271aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMVLIKEFRVVLPCSVQEYQVGQLYSVAEAS KNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGS LVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDP NTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKE LANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFC WIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PITPNb (Phosphatidylinositol Transfer Protein, Beta) is an important member of the phosphatidylinositol transfer protein family, which plays a crucial role in lipid metabolism and cell signaling. Research has identified PITPNb as a key mediator in various cellular processes, including membrane trafficking, signal transduction, and cytoskeletal dynamics. Its primary function is to facilitate the transfer of phosphatidylinositol and its phosphate derivatives between cellular membranes, a process that is vital for maintaining membrane integrity and function. Recent studies have also implicated PITPNb in several pathological conditions, including cancer, neurodegenerative diseases, and inflammation. The recombinant expression of PITPNb allows scientists to explore its structure-function relationships, study its interactions with other proteins and lipids, and uncover its potential as a therapeutic target. By generating recombinant PITPNb, researchers can perform biochemical assays and structural analyses that contribute to understanding its role in cellular physiology and disease states.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US