Analytical Data
-
Gene name
PPP2CA
- Application
-
Alternative Names
PPP2CA;Serine/threonine-Protein phosphatase 2A catalytic subunit alpha isoform
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P67775
-
Expression Region
1-309aa
-
AA Sequence
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
-
Molecular Weight
43.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPP2CA, encoding the catalytic subunit of protein phosphatase 2A (PP2A), is a critical regulator of various cellular processes, including cell growth, division, and apoptosis. PP2A is a major serine/threonine phosphatase implicated in the regulation of multiple signaling pathways, such as those influenced by oncogenes and tumor suppressors. Dysregulation of PP2A activity has been associated with various diseases, particularly cancers, where alterations in its subunits can lead to aberrant signaling and tumor progression. Research on PPP2CA has garnered attention due to its potential as a therapeutic target; restoring PP2A function could counteract oncogenic signaling. Recombinant PPP2CA protein is essential for studying its biochemical properties, interactions with regulatory subunits, and the phosphatase's impact on cellular functions. By utilizing recombinant technology, researchers can generate sufficient quantities of purified PPP2CA for structural and functional assays, allowing a deeper understanding of its role in cellular signaling networks. This knowledge could pave the way for novel therapeutic strategies aimed at reactivating PP2A activity in cancer and other diseases where its function is compromised.











