Analytical Data
-
Gene name
LYPD4
- Application
-
Alternative Names
LYPD4; UNQ2552/PRO6181Ly6/PLAUR domain-containing protein 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UWN0
-
Expression Region
1-211aa
-
AA Sequence
MGPQHLRLVQLFCLLGAISTLPRMSCGAGCYKTQKGTARGVVGFKGCSSSSSYPAQISYLVSPPGVSIASYSRVCRSYLCNNLTNLEPFVKLKASTPKSITSASCSCPTCVGEHMKDCLPNFVTTNSCPLAASTCYSSTLKFQAGFLNTTFLLMGCAREHNQLLADFHHIGSIKVTEVLNILEKSQIVGAASSRQDPAWGVVLGLLFAFRD
-
Molecular Weight
49 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LYPD4 (Ly6/PLAUR domain-containing protein 4) is a member of the Ly6 protein family, which plays crucial roles in various biological processes, including cell adhesion, immune response, and neuronal function. The study of LYPD4 has gained significant attention due to its potential implications in cancer biology and autoimmune diseases. It is primarily expressed in immune cells and has been linked to the modulation of T cell function and the regulation of inflammatory responses. Recent research has suggested that LYPD4 might act as a novel immune checkpoint, influencing tumor microenvironments and potentially serving as a therapeutic target in cancer treatment. Moreover, understanding the structure and function of LYPD4 could illuminate its role in facilitating cell-cell interactions and signaling pathways that are essential for immune regulation. Given the increasing interest in immune checkpoint inhibitors and targeted therapies, the characterization of LYPD4 as a recombinant protein could pave the way for new therapeutic strategies aimed at enhancing anti-tumor immunity or managing autoimmune conditions. Thus, exploring the properties and mechanisms of LYPD4 not only contributes to the fundamental understanding of immune regulation but also holds promise for future clinical applications in oncology and immunology.
