Analytical Data
-
Gene name
H2BC12
- Application
-
Alternative Names
H2BC12；H2BFT；HIRIP1；HIST1H2BK；Histone H2B type 1-K
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60814
-
Expression Region
2-126aa
-
AA Sequence
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
-
Molecular Weight
21.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H2BC12, a member of the histone H2B family, has garnered attention in research due to its potential roles in chromatin structure, gene regulation, and cellular processes. Histone proteins play crucial roles in DNA wrapping and organization within the nucleus, influencing gene expression and the overall cell cycle. H2BC12, specifically, has been linked to various epigenetic modifications that are essential for DNA repair, replication, and the maintenance of genome stability. Its distinctive expression patterns in different tissues and its involvement in cellular differentiation highlight its significance in developmental biology and pathology. Recent studies have suggested that alterations in H2BC12 expression may correlate with certain diseases, including cancer, where dysregulation of histone proteins can lead to aberrant gene expression profiles. Consequently, understanding the function and mechanism of H2BC12 could provide insights into fundamental biological processes and potential therapeutic targets for disease intervention. Research on H2BC12 seeks to elucidate its structure-function relationships, post-translational modifications, and interactions with other nuclear proteins, aiming to comprehensively map its impact on cellular homeostasis and disease progression. This growing body of knowledge may eventually enable the development of novel strategies for manipulating gene expression and addressing various medical conditions.
