Analytical Data
-
Gene name
DDX60
- Application
-
Alternative Names
DDX60；Probable ATP-dependent RNA helicase DDX60
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IY21
-
Expression Region
772-939aa
-
AA Sequence
LDVVDKNESAVIVAPTSSGKTYASYYCMEKVLKESDDGVVVYVAPTKALVNQVAATVQNRFTKNLPSGEVLCGVFTREYRHDALNCQVLITVPACFEILLLAPHRQNWVKKIRYVIFDEVHCLGGEIGAEIWEHLLVMIRCPFLALSATISNPEHLTEWLQSVKWYWK
-
Molecular Weight
32.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDX60 is a member of the DEAD-box protein family, which plays critical roles in RNA metabolism, including RNA helicase activity, RNA splicing, and ribosome biogenesis. It is characterized by a conserved DEAH box that is essential for its function in unwinding RNA structures. Recent studies have highlighted DDX60's involvement in various cellular processes, including antiviral responses and immune regulation. Research has shown that DDX60 can influence the activation of several signaling pathways, particularly in response to viral infections, suggesting its role as a modulator of innate immunity. Moreover, it has been implicated in the regulation of gene expression and the maintenance of genomic stability. Given its multifaceted roles in crucial biological processes, understanding the structural and functional dynamics of DDX60, particularly through the characterization of its recombinant protein, is gaining attention. Such studies aim to elucidate the mechanistic details of DDX60's interactions with RNA and other protein partners, providing insights into its regulatory functions in pathological conditions such as cancer and viral diseases. Thus, the research into DDX60 recombinant protein serves not only to expand our knowledge of RNA-related cellular mechanisms but also to potentially uncover novel therapeutic strategies targeting DDX60-driven pathways.
