Analytical Data
-
Gene name
LUZP5
- Application
-
Alternative Names
NCAPG2. LUZP5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86XI2
-
Expression Region
177-274aa
-
AA Sequence
TKTGADVCRLWRIHQALYCFDYDLEESGEIKDMLLECFININYIKKEEGRRFLSCLFNWNINFIKMIHGTIKNQLQGLQKSLMVYIAEIYFRAWKKAS
-
Molecular Weight
36.52 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LUZP5, a member of the LUZP family of proteins, has garnered attention in recent years due to its potential roles in cellular processes and its implications in various diseases. Initially characterized as a gene involved in the regulation of cell proliferation and differentiation, LUZP5 has been linked to processes such as cell adhesion, signaling pathways, and tissue development. Investigations into its structure have revealed distinct functional domains that suggest a multifaceted role in cellular homeostasis. Furthermore, dysregulation of LUZP5 expression has been associated with certain malignancies, prompting researchers to delve deeper into its mechanistic functions and interactions at the molecular level. The recombinant expression of LUZP5 provides a valuable tool for exploring its biochemical properties and potential therapeutic targets. By generating and characterizing LUZP5 recombinant protein, researchers can utilize advanced techniques such as crystallography and mutagenesis to elucidate its function and relevance in both normal physiology and pathological conditions. This ongoing research aims to uncover the potential of LUZP5 as a biomarker or therapeutic target, contributing to our understanding of its role in health and disease.
