Cat: PA2000-9109

Recombinant Human LUZP5 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LUZP5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NCAPG2. LUZP5

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q86XI2

  • Expression Region

    177-274aa

  • AA Sequence

    TKTGADVCRLWRIHQALYCFDYDLEESGEIKDMLLECFININYIKKEEGRRFLSCLFNWNINFIKMIHGTIKNQLQGLQKSLMVYIAEIYFRAWKKAS

  • Molecular Weight

    36.52 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LUZP5, a member of the LUZP family of proteins, has garnered attention in recent years due to its potential roles in cellular processes and its implications in various diseases. Initially characterized as a gene involved in the regulation of cell proliferation and differentiation, LUZP5 has been linked to processes such as cell adhesion, signaling pathways, and tissue development. Investigations into its structure have revealed distinct functional domains that suggest a multifaceted role in cellular homeostasis. Furthermore, dysregulation of LUZP5 expression has been associated with certain malignancies, prompting researchers to delve deeper into its mechanistic functions and interactions at the molecular level. The recombinant expression of LUZP5 provides a valuable tool for exploring its biochemical properties and potential therapeutic targets. By generating and characterizing LUZP5 recombinant protein, researchers can utilize advanced techniques such as crystallography and mutagenesis to elucidate its function and relevance in both normal physiology and pathological conditions. This ongoing research aims to uncover the potential of LUZP5 as a biomarker or therapeutic target, contributing to our understanding of its role in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US