Analytical Data
-
Gene name
NT4
- Application
-
Alternative Names
NTF4;NTF5;Neurotrophin-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P34130
-
Expression Region
81-210aa
-
AA Sequence
M+GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAG GSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVR ALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NT4, also known as Neurotrophin-4, is a member of the neurotrophin family, which plays a crucial role in the growth, survival, and differentiation of neurons in the nervous system. The research on NT4 and its recombinant protein forms has gained significant attention due to its potential therapeutic applications in neurodegenerative diseases, nerve injuries, and various neurological disorders. NT4 functions through its receptor, TrkB (tropomyosin receptor kinase B), which is involved in signaling pathways that support neuronal health and function. Unlike other neurotrophins, NT4 is particularly beneficial for certain types of neurons, promoting their survival and enhancing synaptic plasticity. The production of recombinant NT4 protein allows for detailed studies of its effects on neuronal growth and regeneration, paving the way for potential treatment options. Advances in genetic engineering techniques, such as recombinant DNA technology, enable the efficient production and purification of NT4, facilitating various in vitro and in vivo studies. These investigations aim to elucidate NT4's mechanisms of action, optimize its pharmacological properties, and assess its effectiveness in preclinical models. Insights gained from this research not only deepen our understanding of neurotrophic factors but also contribute to the development of innovative therapies to combat debilitating neurological conditions. Overall, the study of NT4 recombinant proteins holds promise for the advancement of neurobiology and neurotherapeutics, addressing a critical need for effective treatments in neurology.











