Analytical Data
-
Gene name
MBD2
- Application
-
Alternative Names
MBD2;Methyl-CpG-binding domain Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBB5
-
Expression Region
143-411aa
-
AA Sequence
ATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
-
Molecular Weight
45.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MBD2 (methyl-CpG binding domain protein 2) is a key member of the MBD family of proteins, which play critical roles in the regulation of gene expression through the recognition of methylated DNA. MBD2 specifically binds to methylated cytosines in DNA, thereby functioning as a bridge between DNA methylation and chromatin remodeling, which ultimately influences gene silencing and transcriptional repression. The understanding of MBD2's function has significant implications in epigenetics, as alterations in its expression and activity have been linked to various diseases, including cancer and neurological disorders. Recent research has focused on the structural and functional aspects of MBD2, particularly in terms of its ability to interact with other proteins and DNA, which may elucidate its role in gene regulatory networks. The production of recombinant MBD2 proteins is crucial for these studies, enabling scientists to investigate the biochemical properties, binding affinities, and functional mechanisms of MBD2 in detail. Additionally, these recombinant proteins facilitate functional assays and biochemical screenings, paving the way for potential therapeutic applications targeting MBD2-related pathways in disease contexts. Understanding the precise mechanisms by which MBD2 operates can contribute to a deeper knowledge of epigenetic regulation and its role in health and disease.











