Analytical Data
-
Gene name
NRAS
- Application
-
Alternative Names
NRAS;HRAS1;GTPase NRas
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01111
-
Expression Region
1-186aa
-
AA Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC
-
Molecular Weight
56.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NRAS is a member of the RAS oncogene family and plays a crucial role in cellular signaling pathways that regulate cell growth, differentiation, and survival. Mutations in the NRAS gene are frequently associated with various types of cancers, particularly melanoma, and hematological malignancies, making it a significant target for cancer research. The study of NRAS recombinant proteins is essential for understanding the molecular mechanisms underlying these cancers, as well as for the development of targeted therapies. By producing and analyzing NRAS recombinant proteins, researchers can investigate the protein's structure, function, and interactions with other cellular molecules, which may reveal potential therapeutic targets or biomarkers for treatment resistance. Furthermore, NRAS is known to interact with various downstream effectors, including the MAPK and PI3K pathways, contributing to its oncogenic potential. Enhanced insights into NRAS protein dynamics could lead to the identification of novel inhibitors that specifically disrupt its activity, offering new avenues for cancer treatment. In summary, the investigation of NRAS recombinant proteins not only furthers our understanding of cancer biology but also paves the way for innovative therapeutic strategies against NRAS-driven tumors.
