Analytical Data
-
Gene name
SMN
- Application
-
Alternative Names
SMN；SMN；SMNT；SMN2；Survival motor neuron Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16637
-
Expression Region
1-282aa
-
AA Sequence
MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASF KHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSA IWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVAN NIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPM PGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPIC PDSLDDADALGSMLISWYMSGYHTGYYMEMLA
-
Molecular Weight
57 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on SMN (Survival of Motor Neurons) recombinant proteins is driven by the critical role that SMN plays in the survival and maintenance of motor neurons, with implications in neurodegenerative diseases, particularly spinal muscular atrophy (SMA). SMA is a hereditary disorder characterized by the degeneration of motor neurons in the spinal cord, leading to muscle weakness and atrophy. The SMN protein is vital for the assembly of small nuclear ribonucleoproteins (snRNPs) and is involved in RNA processing, making it essential for neuronal health. Mutations or deletions in the SMN1 gene cause reduced levels of SMN protein, which directly correlates with the severity of SMA. Research into SMN recombinant proteins has focused on understanding the functional properties of SMN, exploring the mechanisms underlying SMA pathology, and developing potential therapeutic strategies. By producing recombinant forms of the SMN protein, scientists aim to delineate its structural and functional characteristics, assess its interactions with other cellular components, and investigate the effects of SMN levels on motor neuron viability. This research avenue has opened up possibilities for innovative treatments, including gene therapy and small molecules designed to enhance SMN expression or function, thereby addressing the underlying cause of SMA and improving the prognosis for affected individuals. Overall, the study of SMN recombinant proteins not only contributes valuable insights into the biology of motor neuron diseases but also paves the way for the development of effective therapeutic interventions.
