Analytical Data
-
Gene name
Rnaset2a
- Application
-
Alternative Names
Rnaset2a；Rnase6pl；Ribonuclease T2-A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
C0HKG5
-
Expression Region
30-259aa
-
AA Sequence
GPLWSGSHEWKKLILTQHWPPTVCKEVNSCQDSLDYWTIHGLWPDRAEDCNQSWHFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPSINYYQLADFKDALTRIYGVVPKIQCLMPEQGESVQTVGQIELCFTKEDLHLRNCTEPGEQLSSRQEAWLAMEASTHGMMVCEDGPIFYPPPTKTQH
-
Molecular Weight
34.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Rnaset2a is a protein that has garnered increasing attention in biochemical and molecular biology research due to its critical role in various cellular processes. As a member of the RNA editing enzyme family, Rnaset2a is involved in the regulation of gene expression through RNA modification, which can significantly impact protein synthesis and cellular function. Investigations into Rnaset2a have demonstrated its importance in processes such as neurogenesis and the signaling pathways that regulate cell development and differentiation. Given its potential implications in understanding diseases associated with aberrant RNA editing, including neurodegenerative disorders and certain cancers, researchers are keen to explore its structure and function at a molecular level. Recombinant protein studies of Rnaset2a aim to elucidate its enzymatic activity, interactions with other cellular molecules, and its role in post-transcriptional modification processes. By employing techniques such as gene cloning, expression in heterologous systems, and functional assays, scientists hope to uncover the mechanistic insights necessary for developing therapeutic strategies that target Rnaset2a-related pathways. As the body of research surrounding Rnaset2a expands, it is positioned as a promising candidate for further exploration in both basic and applied sciences.
