Analytical Data
-
Gene name
NKB
- Application
-
Alternative Names
TAC3;NKNB;Tachykinin-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHF0
-
Expression Region
17-121aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMQSFGAVCKEPQEEVVPGGGRSKRDPDLYQ LLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSV QPDSPTDVNQENVPSFGILKYPPRAE
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NKB, or Neuropeptide K, is a neuropeptide that plays a critical role in various physiological processes, including the regulation of stress response, pain perception, and neuroendocrine functions. The study of NKB and its recombinant protein has gained significant attention in the fields of neuroscience and pharmacology due to its potential therapeutic applications. Early research has indicated that NKB interacts with specific neurokinin receptors, influencing neuronal signaling pathways that are implicated in mood disorders and pain-related conditions. Advances in recombinant DNA technology have enabled the production of NKB in a controlled laboratory environment, facilitating in-depth studies of its biological functions and mechanisms of action. Researchers have begun to explore the implications of NKB in various pathological states, including anxiety, depression, and chronic pain syndromes, highlighting its potential as a target for drug development. By understanding the structural properties and interactions of NKB, scientists aim to design specific modulators that can enhance or inhibit its function, potentially leading to novel treatment strategies. Furthermore, the dissection of NKB signaling pathways may reveal insights into the broader neuropeptide signaling network, opening new avenues for the development of therapeutics that address a range of neuropsychiatric disorders. Overall, the ongoing investigation into NKB recombinant protein serves as a foundation for unraveling its physiological roles and therapeutic potential, underscoring the importance of this neuropeptide in both basic and applied research.
