Analytical Data
-
Gene name
S100A15
- Application
-
Alternative Names
S100A15；S100A15；Protein S100-A14
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86SG5
-
Expression Region
2-101aa
-
AA Sequence
SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
-
Molecular Weight
13.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
S100A15 is a member of the S100 protein family, known for its calcium-binding properties and involvement in various cellular processes such as cell growth, differentiation, and inflammatory responses. Research has shown that S100A15 plays a significant role in keratinocyte function and skin physiology, making it a critical protein in dermatological studies. Its expression is notably upregulated in certain inflammatory skin conditions, including psoriasis and eczema, indicating its potential as a biomarker for skin disorders. Furthermore, S100A15 has been implicated in the regulation of immune responses, particularly in the modulation of the activity of various immune cells. The production of recombinant S100A15 protein has facilitated detailed studies into its biochemical properties and functions. By producing this protein in a controlled laboratory environment, researchers can investigate its molecular mechanisms, interactions with other proteins, and its role in skin pathology. This research not only enhances our understanding of S100A15's biological functions but also opens avenues for therapeutic interventions targeting S100A15-related pathways in skin diseases. Overall, the study of S100A15 recombinant protein is crucial for elucidating its role in skin health and disease, with the potential for developing novel diagnostic and therapeutic strategies.
