Analytical Data
-
Gene name
NAPSA
- Application
-
Alternative Names
NAPSA;NAP1;NAPA;Napsin-A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O96009
-
Expression Region
64-420aa
-
AA Sequence
KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
-
Molecular Weight
42.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NAPSA (N-acetylated alpha-linked acidic dipeptidase) is a lysosomal enzyme that plays a critical role in the metabolism of bioactive peptides and has been implicated in various physiological and pathological processes. The enzyme is involved in the degradation of N-acetylated dipeptides, contributing to cellular homeostasis and signaling pathways. Research on NAPSA has gained momentum due to its association with several diseases, including neurodegenerative disorders and certain types of cancers. Understanding the structure and function of NAPSA, as well as the mechanisms regulating its activity, is essential for elucidating its biological roles and potential therapeutic applications. Recent advances in protein engineering and structural biology have enabled scientists to explore NAPSA's conformation and interactions at a molecular level. By characterizing its enzymatic properties and identifying potential inhibitors or activators, researchers aim to develop novel strategies for treating disorders linked to NAPSA dysregulation. This ongoing research not only enhances our comprehension of NAPSA's function but also opens up new avenues for drug discovery and therapeutic intervention in diseases associated with peptide metabolism.
