Analytical Data
-
Gene name
LLPH
- Application
-
Alternative Names
C12orf31; Chromosome 12 open reading frame 31; hLLP; Human LAPS18-like protein; LLP homolog. long-term synaptic facilitation (Aplysia); llph; LLPH_HUMAN; MGC104302; MGC14817; Protein LAPS18-like; Protein LLP homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BRT6
-
Expression Region
1-129aa
-
AA Sequence
MAKSLRSKWKRKMRAEKRKKNAPKEASRLKSILKLDGDVLMKDVQEIATVVVPKPKHCQEKMQCEVKDEKDDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKGLAW
-
Molecular Weight
41.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LLPH (leucine-rich repeat-containing protein 1) is a protein implicated in various biological processes, including cell signaling, immune response, and cellular development. In recent years, researchers have focused on the recombinant production of LLPH to explore its functional properties and potential therapeutic applications. The recombinant technology enables the generation of large quantities of pure LLPH, allowing for detailed studies on its structure and interactions with other proteins. Understanding the biochemical pathways involving LLPH is crucial, as dysregulation of this protein has been linked to several diseases, including neurodegenerative disorders and immune system dysfunctions. Moreover, recombinant LLPH can be utilized in high-throughput screening for drug development, providing insights into new therapeutic targets. As the demand for novel biopharmaceuticals continues to grow, the exploration of LLPH and its variants through recombinant techniques holds significant promise in expanding our understanding of complex cellular mechanisms and developing innovative treatment strategies. The research on LLPH thus represents a vital intersection of molecular biology, biochemistry, and therapeutic discovery.
