Analytical Data
-
Gene name
nanE
- Application
-
Alternative Names
nanE；yhcJ；Putative N-acetylmannosamine-6-phosphate 2-epimerase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8XNZ3
-
Expression Region
1-221aa
-
AA Sequence
MLDVVKGNLIVSCQALSDEPLHSSFIMGRMAIAAKQGGAAAIRAQGVNDINEIKEVTKLPIIGIIKRNYDDSEIYITPTMKEVDELLKTDCEMIALDATKRKRPNGENVKDLVDAIHAKGRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQSNSVDFELLEELVKTVKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQITKRFTDILK
-
Molecular Weight
30.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NanE, a protein of significant interest in the field of microbiology and biotechnology, has gained attention due to its role in the biosynthesis of unique polysaccharides in bacteria. Specifically, NanE is involved in the degradation of sialic acid, a nine-carbon sugar that plays a critical role in various biological processes, including cell signaling and immune response. Sialic acids are commonly found on the surface of cells and have implications in pathogen-host interactions, including bacterial adhesion and immune evasion mechanisms. Understanding the structure and function of NanE is essential for elucidating these mechanisms, as well as for potential biotechnological applications, such as the development of sialic acid-based therapeutics. Recent advances in recombinant protein technology have enabled researchers to produce NanE in heterologous systems, facilitating detailed studies of its enzymatic properties and interactions with substrates. Furthermore, the study of NanE's evolutionary adaptations offers insights into microbial diversity and the evolution of metabolic pathways. As the demand for novel biocatalysts and bioactive compounds grows, the exploration of NanE through recombinant protein expression and characterization presents an exciting avenue for research that may lead to new applications in medicine and industry.
