Analytical Data
-
Gene name
ADHR
- Application
-
Alternative Names
V；ADHR；DIR；DIR3；Vasopressin V2 receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30518
-
Expression Region
1-371aa
-
AA Sequence
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQRNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGPSERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTSS
-
Molecular Weight
40.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ADHR (Autosomal Dominant Hypophosphatemic Rickets) is a genetic disorder characterized by phosphate wasting and impaired bone mineralization, leading to skeletal deformities. The disease is caused by mutations in the FGF23 gene, which encodes a protein that regulates phosphate homeostasis and vitamin D metabolism. Recent studies have highlighted the critical role of FGF23 in bone health and its complex interactions with other hormones involved in calcium and phosphate metabolism. Research into ADHR recombinant proteins aims to better understand the functional mechanisms of FGF23 and its mutations, providing insights into the pathophysiology of this condition. By developing and studying recombinant forms of the FGF23 protein, researchers hope to elucidate its structural and functional properties, which could lead to potential therapeutic strategies for managing ADHR and related disorders. Furthermore, the generation of these recombinant proteins facilitates the exploration of targeted treatments that could help normalize phosphate levels and improve bone health in affected individuals, paving the way for innovative approaches in the treatment of hereditary rickets and metabolic bone diseases. This research not only enhances our understanding of FGF23 but also contributes to the broader field of endocrinology and mineral metabolism, highlighting the significance of protein engineering in addressing complex genetic disorders.
