Cat: PA1000-2069

Recombinant Human N6AMT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    N6AMT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    N6AMT1;C21orf127;HEMK2;KMT9;Methyltransferase N6AMT1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y5N5

  • Expression Region

    1-214aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMNIRNARPEDLMNMQHCNLLCLPENYQMKY YFYHGLSWPQLSYIAEDE NGKIVGYVLAKMEEDPDDVPHGHITSLAVK RSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYS NTL NFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAI ENKVESKGNSPPSSGEACREEK GLAAEDSGGDSKDLSEVSETTESTDV KDSSEASDSAS

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

N6AMT1 (N6-adenosine methyltransferase 1) is a recently characterized enzyme that plays a critical role in the methylation of adenosine residues in RNA, specifically at the N6 position. This methylation process is significant for various cellular functions, including RNA stability, splicing, transport, and translation. Dysregulation of RNA methylation has been implicated in several diseases, including cancer, neurodegenerative disorders, and metabolic syndromes, making N6AMT1 a target of interest for therapeutic intervention. Recent studies have highlighted its importance in regulating gene expression and influencing cellular stress responses. Furthermore, as the understanding of epitranscriptomics—the study of chemical modifications on RNA—expands, N6AMT1 has emerged as a crucial player in the intricate network of RNA modifications. Research into the structural and functional aspects of N6AMT1, including its substrate specificity and interaction with other cellular factors, is essential for developing potential therapeutic strategies aimed at modulating its activity. Additionally, understanding the mechanisms through which N6AMT1 influences RNA biology presents opportunities for innovative approaches in biotechnology and medicine, underscoring the enzyme's relevance in both basic research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US