Analytical Data
-
Gene name
NAT1
- Application
-
Alternative Names
NAT1;AAC1;Arylamine N-acetyltransferase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18440
-
Expression Region
1-290aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMDIEAYLERIGYKKSRNKLDLETLTDILQH QIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALT TIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQ MWQPLELISGKDQPQVPCIFRLTEENGFWYLDQIRREQYIPNEEFLHSDL LEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPASVFTSKSFCSLQTPDG VHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLV PKHGDRFFTI
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NAT1, or N-acetyltransferase 1, is an important enzyme involved in drug metabolism and the detoxification of various xenobiotics in the human body. Its role is crucial in pharmacogenomics, as polymorphisms in the NAT1 gene can lead to interindividual variability in drug response and susceptibility to certain diseases, including cancer. Recent studies have highlighted that the expression and activity of NAT1 can be influenced by genetic, environmental, and dietary factors. The development of NAT1 recombinant proteins has provided researchers with valuable tools to study the enzyme's structure-function relationship and to explore how variations might affect enzymatic activity. Furthermore, the production of NAT1 recombinant proteins allows for high-throughput screening of potential drug candidates and the investigation of drug-drug interactions. As a result, understanding the biochemical mechanisms of NAT1 through recombinant protein studies could pave the way for personalized medicine approaches that optimize drug efficacy and minimize adverse effects for patients based on their genetic makeup. Overall, research into NAT1 recombinant proteins not only enhances our understanding of metabolism but also contributes to the broader field of pharmacogenetics and drug discovery.
