Analytical Data
-
Gene name
NTMT1
- Application
-
Alternative Names
CENPA;Histone H3-like centromeric Protein A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BV86
-
Expression Region
1-223aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAGENFATPFHGHVGRGAFSDVYEPAE DTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTD INPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVV TPPQEVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKEN NPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NTMT1, or N-terminal methyltransferase 1, is an important enzyme involved in the post-translational modification of proteins through methylation, specifically at the N-terminal methionine residue. This modification is critical for regulating protein stability, localization, and function, influencing various biological processes such as gene expression, signal transduction, and cell differentiation. Recent studies have highlighted the role of NTMT1 in various cellular contexts, including its implications in cancer biology, where altered expression levels may correlate with tumor progression and metastasis. The increasing interest in NTMT1 as a potential therapeutic target necessitates the development of recombinant NTMT1 proteins to facilitate detailed biochemical studies, allowing researchers to elucidate its mechanistic roles and regulatory pathways. By employing advanced protein engineering techniques, scientists can produce this enzyme in sufficient quantities and with the desired purity for structural and functional analyses. Understanding the nuances of NTMT1’s activity, interactions, and regulation may provide insights into novel strategies for therapeutic intervention in diseases characterized by dysregulated methylation processes. Consequently, the study of recombinant NTMT1 not only enhances our fundamental understanding of protein methylation but also offers potential implications for drug development and personalized medicine.











