Cat: PA1000-2068

Recombinant Human NTMT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NTMT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CENPA;Histone H3-like centromeric Protein A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BV86

  • Expression Region

    1-223aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAGENFATPFHGHVGRGAFSDVYEPAE DTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTD INPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVV TPPQEVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKEN NPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NTMT1, or N-terminal methyltransferase 1, is an important enzyme involved in the post-translational modification of proteins through methylation, specifically at the N-terminal methionine residue. This modification is critical for regulating protein stability, localization, and function, influencing various biological processes such as gene expression, signal transduction, and cell differentiation. Recent studies have highlighted the role of NTMT1 in various cellular contexts, including its implications in cancer biology, where altered expression levels may correlate with tumor progression and metastasis. The increasing interest in NTMT1 as a potential therapeutic target necessitates the development of recombinant NTMT1 proteins to facilitate detailed biochemical studies, allowing researchers to elucidate its mechanistic roles and regulatory pathways. By employing advanced protein engineering techniques, scientists can produce this enzyme in sufficient quantities and with the desired purity for structural and functional analyses. Understanding the nuances of NTMT1’s activity, interactions, and regulation may provide insights into novel strategies for therapeutic intervention in diseases characterized by dysregulated methylation processes. Consequently, the study of recombinant NTMT1 not only enhances our fundamental understanding of protein methylation but also offers potential implications for drug development and personalized medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US