Analytical Data
-
Gene name
csgA
- Application
-
Alternative Names
csgA；ERAB；HADH2；MRPP2；3-hydroxyacyl-CoA dehydrogenase type-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q93U24
-
Expression Region
21-152aa
-
AA Sequence
GVVPQYGGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQADARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKDSHMTVKQFGGGNGAAVDQTASNSTVNVTQVGFGNNATAHQY
-
Molecular Weight
14.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of recombinant CsgA protein has garnered significant attention due to its role in biofilm formation and amyloid fibril assembly in various bacterial species, particularly in Escherichia coli. CsgA is a crucial component of the curli fibers, which are involved in cell adhesion and the formation of extracellular matrix structures. Understanding CsgA has important implications in microbiology and medicine, as bacterial biofilms are associated with persistent infections and antibiotic resistance. Researchers have focused on the genetic and biochemical properties of CsgA to elucidate its structure-function relationship and to explore potential applications in biotechnology and drug development. The recombinant production of CsgA allows for in-depth studies of its aggregation behavior and interactions with host cells, paving the way for the development of novel strategies to combat biofilm-related infections. Additionally, CsgA is a model protein for studying amyloidogenesis, which has broader implications in understanding various amyloid diseases in humans. Therefore, investigating recombinant CsgA not only advances our fundamental knowledge of microbial physiology but also enhances our capacity to address significant health challenges posed by biofilm-associated pathogens.
