Cat: PA1000-2053

Recombinant Human MYL12A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MYL12A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MYL12A;MLCB;MRLC3;RLC;Myosin regulatory light chain 12A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P19105

  • Expression Region

    1-171aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMSSKRTKTKTKKRPQRATSNVFAMFD QSQIQEFKEAFNMIDQNR DGFIDKEDLHDMLASLGKNPTDEYLDAMMN EAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE DYL RELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD

  • Molecular Weight

    22 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MYL12A, also known as myosin light chain 12A, is an essential component of the contractile apparatus in various muscle and non-muscle cells. It plays a crucial role in the regulation of smooth muscle contraction and cytokinesis in dividing cells. Research into MYL12A has gained momentum due to its involvement in several physiological and pathological processes, including vascular function, cell motility, and tumor progression. Dysregulation of MYL12A has been linked to various diseases, such as hypertension and cancer, making it a potential therapeutic target. Recent studies employing recombinant MYL12A proteins have facilitated a deeper understanding of its structural and functional properties, as well as its interactions with other cellular proteins. These advances are crucial for elucidating the mechanisms of muscle contraction and cell dynamics. By generating and characterizing recombinant MYL12A, researchers aim to explore its role in cellular processes and its potential implications in disease pathology, paving the way for novel diagnostic and therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US