Analytical Data
-
Gene name
IL32
- Application
-
Alternative Names
NPPB；Natriuretic peptides B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16860
-
Expression Region
1-134aa
-
AA Sequence
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
-
Molecular Weight
14.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL-32, a pro-inflammatory cytokine, plays a crucial role in various immune responses and has been implicated in several diseases, including inflammatory disorders and cancers. This cytokine is predominantly produced by immune cells such as T cells, natural killer cells, and monocytes, and it participates in the regulation of inflammatory processes by inducing other cytokines, chemokines, and adhesion molecules. Studies have shown that IL-32 can influence the function of various cell types, enhancing the immune response against pathogens and potentially contributing to tissue damage in autoimmune conditions. The recombinant protein form of IL-32 has garnered interest for its potential therapeutic applications, particularly in modulating immune responses in chronic inflammatory and infectious diseases. Researchers are exploring the mechanisms by which IL-32 exerts its effects, including its signaling pathways and interactions with other immune factors. Furthermore, the ability to produce recombinant IL-32 provides a valuable tool for investigating its biological functions and developing novel therapeutic strategies that target IL-32 pathways to manage disease conditions. Given the increasing recognition of IL-32’s significance in immune regulation, ongoing research aims to elucidate its precise roles and therapeutic potential, thereby paving the way for advancements in immunotherapy and personalized medicine.
