Analytical Data
-
Gene name
CD20
- Application
-
Alternative Names
CD20；CD20；B-lymphocyte antigen CD20
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11836
-
Expression Region
1-297aa
-
AA Sequence
MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESK TLGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSL LAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKME SLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF AFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLT ETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
-
Molecular Weight
58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD20 is a transmembrane protein primarily expressed on the surface of B lymphocytes and plays a crucial role in B cell development and activation. Its unique expression pattern makes it an attractive target for therapeutic interventions in various B cell-related diseases, particularly in hematological malignancies such as non-Hodgkin lymphoma and chronic lymphocytic leukemia. The development of anti-CD20 monoclonal antibodies, such as Rituximab, has revolutionized the treatment landscape for these conditions, significantly improving patient outcomes. However, challenges such as resistance to therapy and the need for more effective therapeutic strategies have prompted ongoing research into CD20. Recombinant CD20 protein has emerged as a valuable tool for studying the biology of B cells and the mechanisms of action of anti-CD20 therapies. By producing CD20 in recombinant systems, researchers can investigate its structural and functional properties, explore the dynamics of B cell signaling, and develop novel therapeutic agents that can enhance the efficacy of CD20-targeted treatments. Additionally, recombinant CD20 can serve as a basis for the design of bispecific antibodies and other innovative modalities aimed at improving the specificity and effectiveness of B cell-targeting therapies, thus holding promise for advancing treatment options for patients with B cell malignancies. Overall, the research surrounding recombinant CD20 protein is pivotal in understanding B cell biology and developing next-generation immunotherapies.
