Analytical Data
-
Gene name
LETM2
- Application
-
Alternative Names
LETM2; LETM1 domain-containing protein LETM2. mitochondrial; LETM1 and EF-hand domain-containing protein 2; Leucine zipper-EF-hand-containing transmembrane protein 1-like
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q2VYF4
-
Expression Region
1-396aa
-
AA Sequence
MKNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATKHPQVTSPQATKETGMEIKEGKQSYRQKIMDELKYYYNGFYLLWIDAKVAARMVWRLLHGQVLTRRERRREEKQKKKMAVKLELAKFLQETMTEMARRNRAKMGDASTQLSSYVKQVQTGHKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRARGMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFTESKENMVDLAPQLKGTKDEDFIQPPPVTSSPITPSTPISLPKGPITSSEEPTLQAKSQMTAQNSKASSKGA
-
Molecular Weight
71.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LETM2 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 2) is a vital protein implicated in various cellular processes, including calcium homeostasis and mitochondrial function. Research surrounding LETM2 has gained traction due to its association with several diseases, particularly in the context of neurodegenerative disorders and mitochondrial dysfunction. As a transmembrane protein predominantly located in the mitochondria, LETM2 is believed to play a crucial role in maintaining mitochondrial integrity and facilitating communication between mitochondria and other cellular components. Investigations into LETM2 include its structural characteristics, functional mechanisms, and potential pathological roles in disorders such as Parkinson's disease and certain types of cancer. The recombinant expression of LETM2 enables researchers to study its properties in detail, explore its interactions with other proteins, and evaluate its effects on cellular metabolism. Understanding the molecular functions of LETM2 can provide insights into its role in disease mechanisms, and may open avenues for developing targeted therapies. Overall, the research on LETM2 recombinant protein serves as an essential foundation for unlocking the complexities of mitochondrial biology and its implications in health and disease.











