Cat: PA1000-2046

Recombinant Human MVD Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MVD

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MVD;MPD;Diphosphomevalonate decarboxylase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P53602

  • Expression Region

    1-400aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMASEKPLAAVTCTAPVNIAVIKYWGKRDEE LVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDVGQPRLQ ACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAG YACLAYTLARVYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKD SIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAE SVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAI SWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAEFVAAVWHGF PPGSNGDTFLKGLQVRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQ ILDDPCAHLLGPDGLPKPAA

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of MVD (mevalonate diphosphate decarboxylase) recombinant protein has gained significant attention in the field of biochemistry and molecular biology due to its vital role in the mevalonate pathway, which is essential for the biosynthesis of isoprenoids, sterols, and hormones in various organisms. This pathway is not only crucial for cellular metabolism but also serves as a target for therapeutic intervention in diseases such as cancer and cardiovascular disorders. Understanding the structure and function of MVD is pivotal for elucidating the mechanistic details of isoprenoid biosynthesis. By producing recombinant MVD protein in various expression systems, researchers can investigate its enzymatic properties, regulatory mechanisms, and interactions with substrates and inhibitors. This research could pave the way for the development of novel drugs that can modulate this pathway, thus providing potential therapeutic strategies for related metabolic diseases. Additionally, the characterization of MVD at the molecular level can enhance our understanding of evolutionary biology, as variations in this enzyme may influence the metabolic capabilities of different organisms. Overall, the exploration of MVD recombinant protein represents a significant endeavor in both fundamental research and applied sciences.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US