Analytical Data
-
Gene name
LGALS12
- Application
-
Alternative Names
Gal-12; Galectin related inhibitor of proliferation; Galectin-12; Galectin-related inhibitor of proliferation; GRIP1; Lectin galactoside binding soluble 12 (galectin 12) ; LEG12_HUMAN; Lgals12
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DT0
-
Expression Region
1-366aa
-
AA Sequence
MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLKLALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS
-
Molecular Weight
62.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Recombinant human LGALS12, also known as galectin-12, is part of the galectin family of proteins, which are characterized by their ability to bind specific carbohydrates and are implicated in various biological processes, including cell adhesion, apoptosis, and immune responses. LGALS12 is predominantly expressed in adipose tissue and has been associated with metabolic functions, particularly in the context of obesity and insulin sensitivity. Research indicates that it may play a role in the regulation of inflammation and adipocyte differentiation, impacting energy homeostasis and metabolic disorders. Understanding the structure and function of LGALS12, particularly as a recombinant protein, is crucial for elucidating its potential therapeutic applications. Furthermore, studies involving LGALS12 can provide insights into its interactions with other cellular molecules and its influence on signaling pathways related to metabolic diseases. The development of recombinant LGALS12 not only aids in producing more significant quantities of the protein for detailed functional and biochemical studies but also opens avenues for novel treatments targeting metabolic syndromes. Thus, the investigation of LGALS12 as a recombinant protein serves as a bridge between fundamental research and clinical applications, fostering advancements in the understanding of metabolic regulation and potential intervention strategies.
