Analytical Data
-
Gene name
ITGa2B
- Application
-
Alternative Names
ITGa2B；CIB；KIP；PRKDCIP；Calcium and integrin-binding Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08514
-
Expression Region
639-887aa
-
AA Sequence
CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR
-
Molecular Weight
33.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ITGa2B, also known as integrin alpha-2b, is a crucial protein that plays a significant role in cell adhesion, migration, and signaling processes, particularly in the context of platelet function and hemostasis. It forms a heterodimer with integrin beta-3 to create the glycoprotein IIb/IIIa complex, which is essential for platelet aggregation. Abnormalities in ITGa2B expression or function are linked to various pathological conditions, including thromboembolic disorders and cardiovascular diseases. Research into the recombinant expression of ITGa2B focuses on understanding its structural and functional properties, which can shed light on its role in both normal physiology and disease states. By utilizing techniques such as molecular cloning and protein purification, scientists aim to produce sufficient quantities of ITGa2B to study its interactions with ligands and other cellular components. This research not only enhances our understanding of integrin biology but also opens up potential therapeutic avenues, such as the development of antiplatelet agents that could help manage conditions associated with excessive platelet activation. Moreover, studying recombinant ITGa2B offers insight into its potential as a biomarker for cardiovascular diseases, facilitating earlier diagnosis and more effective treatment strategies. Overall, the exploration of ITGa2B through recombinant techniques represents a vital area of investigation in both basic and applied biomedical research.
