Cat: PA1000-2035

Recombinant Human MTHFD2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MTHFD2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MTHFD2;NMDMC;Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P13995

  • Expression Region

    30-350aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSLAAVRNEAVVISGRKLAQQIKQEVRQE VEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPA SISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDG FHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVG MPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGI PNLITADMIKEGAAVIDVGINRVHDPVTAKPKLVGDVDFEGVRQKAGYIT PVPGGVGPMTVAMLMKNTIIAAKKVLRLEEREVLKSKELGVATN

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MTHFD2 (Methylenetetrahydrofolate dehydrogenase 2) is a pivotal enzyme involved in one-carbon metabolism, particularly in the de novo synthesis of purines and amino acids. This enzyme catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate, playing a crucial role in the folate cycle. MTHFD2 has garnered significant attention in cancer research because it is often overexpressed in various cancer types, facilitating rapid cell proliferation and tumor growth by providing essential metabolites. Its unique expression pattern in cancer cells as compared to normal tissues presents a potential target for therapeutic intervention. Studies have shown that inhibiting MTHFD2 could disrupt nucleotide synthesis and diminish the growth of cancer cells. Additionally, MTHFD2 has been linked to mitochondrial metabolism, further highlighting its role in cellular energy production and overall cell homeostasis. The exploration of recombinant MTHFD2 protein is crucial for understanding its enzymatic properties, interaction with potential inhibitors, and its function within cellular metabolic pathways. Consequently, characterizing recombinant MTHFD2 can pave the way for the development of novel anti-cancer strategies and enhance our understanding of its implications in metabolic disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US