Analytical Data
-
Gene name
LCE3C
- Application
-
Alternative Names
LCE3C; LEP15; SPRL3ALate cornified envelope protein 3C; Late envelope protein 15; Small proline-rich-like epidermal differentiation complex protein 3A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T5A8
-
Expression Region
1-94aa
-
AA Sequence
MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHFRSHQCRRQRSNSCDRGSGQQGGGSCRGHGSGGCC
-
Molecular Weight
10.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LCE3C (Late Cornified Envelope 3C) is a member of the LCE gene family, which plays a crucial role in the formation of the cornified envelope, a structural component of the skin's outermost layer, the stratum corneum. This layer is essential for barrier function, protecting against environmental insults and preventing water loss. Studies have identified LCE3C as being involved in skin homeostasis, differentiation, and immune response. Its expression is often upregulated in conditions such as psoriasis and eczema, indicating its potential role in inflammatory skin diseases. Additionally, LCE3C has been linked to the regulation of antimicrobial peptides, suggesting its involvement in innate immunity. The investigation of LCE3C recombinant protein is crucial for understanding its specific functions, interactions with other skin proteins, and potential therapeutic applications. Functional studies of LCE3C can offer insights into its contributions to skin health and disease, paving the way for innovative treatments for skin disorders that involve dysregulation of cornification and barrier function.
