Analytical Data
-
Gene name
LCE3B
- Application
-
Alternative Names
LCE3B; LEP14Late cornified envelope protein 3B; Late envelope protein 14
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TA77
-
Expression Region
1-95aa
-
AA Sequence
MSCQQNQQQCQPLPKCPSPKCPPKSSAQCLPPASSCCAPRPGCCGGPSSEGGCCLSHHRCCRSHRCRRQSSNSCDRGSGQQDGASDCGYGSGGCC
-
Molecular Weight
10.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LCE3B (Late Cornified Envelope 3B) is a member of the LCE gene family, which plays a crucial role in the skin's barrier function and maintains homeostasis. This protein is predominantly expressed in the epidermis, where it contributes to the terminal differentiation of keratinocytes and the formation of the stratum corneum, the outermost layer of skin. LCE3B has garnered attention in dermatological research due to its potential association with various skin disorders, including psoriasis and atopic dermatitis. Studies have indicated that alterations in LCE3B expression may influence inflammation and keratinocyte proliferation, which are pivotal in the pathophysiology of these conditions. Additionally, LCE3B is involved in innate immune responses, suggesting that it may play a role in the skin's defense against microbial pathogens. Recent advancements in recombinant protein technology have enabled the production of LCE3B for further investigation of its functional properties and therapeutic potential. Understanding the structure and activity of LCE3B could lead to novel strategies for treating skin diseases and enhancing skin repair mechanisms. As such, the study of LCE3B recombinant protein serves as a promising avenue for elucidating the molecular mechanisms underlying skin health and disease, with implications for targeted therapies and cosmetic applications.
