Analytical Data
-
Gene name
MRPS25
- Application
-
Alternative Names
MRPS25;RPMS25;Small ribosomal subunit Protein mS25
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P82663
-
Expression Region
1-173aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMPMKGRFPIRRTLQYLSQGNVVFKDSV KVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLR FYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPA NFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPS25, a mitochondrial ribosomal protein, plays a critical role in the synthesis of mitochondrial proteins, which are essential for oxidative phosphorylation and cellular energy metabolism. The importance of MRPS25 is underscored by its involvement in the mitochondrial translation machinery, where it contributes to the assembly and stabilization of the mitochondrial ribosome. Disruptions in MRPS25 function have been linked to various mitochondrial diseases, which are often characterized by energy deficiencies and can result in severe clinical manifestations. Recent studies have focused on characterizing the structural and functional properties of MRPS25, as well as its interactions with other mitochondrial ribosomal components. Additionally, the exploration of MRPS25 in different pathological contexts has sparked interest in its potential as a biomarker or therapeutic target, particularly in diseases associated with impaired mitochondrial function, such as neurodegenerative disorders and metabolic syndromes. Understanding the precise role of MRPS25 in mitochondrial biogenesis and function is crucial for developing strategies to combat these diseases and improve mitochondrial health. Thus, ongoing research aims to unravel the molecular mechanisms underlying MRPS25 function and its implications for mitochondrial biology and medicine.
