Analytical Data
-
Gene name
LCE2C
- Application
-
Alternative Names
LCE2C; LEP11Late cornified envelope protein 2C; Late envelope protein 11
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TA81
-
Expression Region
1-110aa
-
AA Sequence
MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSSGGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC
-
Molecular Weight
12.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LCE2C (Late Cornified Envelope 2C) is a gene belonging to the LCE family, which plays a pivotal role in the formation of the skin barrier and in the regulation of epidermal differentiation. Research into LCE2C is particularly significant due to its implications in skin-related disorders, including psoriasis, dermatitis, and other keratinization disorders. The expression of LCE2C is regulated by various factors, including cytokines and environmental stressors, making it crucial for understanding the adaptive mechanisms of skin under pathological conditions. Given its role in keratinocyte function and the overall integrity of the skin barrier, LCE2C is considered a promising target for therapeutic interventions in skin diseases. Furthermore, the recombinant expression of LCE2C can facilitate the exploration of its functional properties and interactions within the epidermis. By producing LCE2C as a recombinant protein, researchers can conduct detailed studies on its biochemical properties, structural characteristics, and potential interactions with other proteins, thus enhancing our understanding of its biological functions. This knowledge can pave the way for innovative treatments and diagnostic tools in dermatology, fundamentally contributing to skin health and disease management. The investigation of LCE2C and its potential applications has emerged as a critical area of research aimed at elucidating the complex mechanisms of skin biology and therapy.
