Analytical Data
-
Gene name
LCE1F
- Application
-
Alternative Names
LCE1F; LEP6Late cornified envelope protein 1F; Late envelope protein 6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T754
-
Expression Region
1-118aa
-
AA Sequence
MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGCCSSGGGGCCSSGGGGCCLSHHRRRRSHRHRPQSSDCCSQPSAGSSCCGGGSGQHSGGCC
-
Molecular Weight
39.93 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LCE1F, a member of the late cornified envelope (LCE) family, is a protein that plays a critical role in skin barrier function and the regulation of keratinocyte differentiation. Research has underscored its importance in the epidermal layer of the skin, where it contributes to the formation of the cornified envelope, a structure vital for maintaining the skin's integrity and hydration. Mutations or variations in the LCE1F gene have been linked to several skin disorders, including psoriasis and atopic dermatitis, indicating its potential as a biomarker for these conditions. The study of LCE1F recombinant protein is particularly relevant for developing therapeutic strategies aimed at enhancing skin barrier function and treating skin diseases. By understanding the functional mechanisms of LCE1F, researchers can explore its role in cellular processes such as apoptosis, inflammation, and immune response. Moreover, the characterization of LCE1F facilitates the development of novel cosmetic and dermatological products designed to improve skin health. Overall, LCE1F represents a meaningful target for both basic and translational research in dermatology, with implications for the design of effective treatments for skin-related ailments.
