Analytical Data
-
Gene name
MRPS2
- Application
-
Alternative Names
MRPS2;Small ribosomal subunit Protein uS2m
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y399
-
Expression Region
1-296aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMATSSAALPRILGAGARAPSRWLGFLG KATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHSDFFNVKE LFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQL ALNFTAHMAYRKGIILFISRNRQFSYLIENMARDCGEYAHTRYFRGGMLT NARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNC NPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQK EPGDQGPAHPPGADMSHSL
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPS2 (Mitochondrial Ribosomal Protein S2) is a crucial component of the mitochondrial ribosome, playing a vital role in protein synthesis within mitochondria. As mitochondria are the powerhouse of the cell, responsible for generating ATP through oxidative phosphorylation, understanding MRPS2's function is pivotal for elucidating mitochondrial biology and its implications in various diseases. Research has shown that mutations in MRPS2 can lead to mitochondrial dysfunction, which is associated with a range of disorders, including myopathy, cardiomyopathy, and other metabolic diseases. Additionally, MRPS2 is implicated in the aging process and conditions such as cancer, where mitochondrial dysregulation is a common feature. Recent studies aim to characterize the structure and biochemical properties of MRPS2, exploring its interactions with other mitochondrial ribosomal proteins and the mitochondrial translation machinery. This research is not only significant for basic science but also holds therapeutic potential, as targeting mitochondrial dysfunction could lead to novel interventions for mitochondrial diseases and conditions linked to metabolic dysregulation. Understanding MRPS2 at the molecular level could also provide insights into the evolutionary adaptations of mitochondrial protein synthesis, given its unique characteristics compared to cytosolic ribosomal proteins. Overall, the investigation of MRPS2 and its role in mitochondrial biology is essential for advancing our knowledge of cellular metabolism and developing strategies to combat mitochondrial-related diseases.
