Cat: PA1000-2018

Recombinant Human MRPL48 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MRPL48

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MRPL48;Large ribosomal subunit Protein mL48

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96GC5

  • Expression Region

    29-212aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSSGEKPIYSVGGILLSISRPYKTKPTHG IGKYKHLIKAEEPKKKKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAES YAQYVHNLCNSLSIKVEESYAMPTKTIEVLQLQDQGSKMLLDSVLTTHER VVQISGLSATFAEIFLEIIQSSLPEGVRLSVKEHTEEDFKGRFKARPELE ELLAKLK

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MRPL48, a mitochondrial ribosomal protein, is part of the large subunit of the mitochondrial ribosome and plays a crucial role in mitochondrial protein synthesis. The study of MRPL48 is significant due to its potential impact on mitochondrial function and cellular metabolism, as mitochondria are vital for energy production and regulation of cellular apoptosis. Dysfunction in mitochondrial proteins, including MRPL48, has been implicated in various metabolic disorders and degenerative diseases, such as cancer, neurodegenerative disorders, and myopathies. Recent research has revealed that alterations in MRPL48 expression or function can lead to mitochondrial dysfunction, highlighting its role in maintaining mitochondrial integrity and overall cellular homeostasis. Understanding the structure, function, and regulation of MRPL48 may provide insights into the molecular mechanisms underlying mitochondrial-related diseases, and could pave the way for the development of therapeutic strategies aimed at restoring proper mitochondrial function. Additionally, studying the interactions of MRPL48 with other mitochondrial components can enhance our knowledge of ribosome biogenesis and protein synthesis within mitochondria, which is crucial for the proper expression of mitochondrial genes encoded by both nuclear and mitochondrial DNA. This comprehensive understanding is essential for revealing how MRPL48 and its associated pathways may be targeted in the management of various diseases linked to mitochondrial dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US