Analytical Data
-
Gene name
MRPL48
- Application
-
Alternative Names
MRPL48;Large ribosomal subunit Protein mL48
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96GC5
-
Expression Region
29-212aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSSGEKPIYSVGGILLSISRPYKTKPTHG IGKYKHLIKAEEPKKKKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAES YAQYVHNLCNSLSIKVEESYAMPTKTIEVLQLQDQGSKMLLDSVLTTHER VVQISGLSATFAEIFLEIIQSSLPEGVRLSVKEHTEEDFKGRFKARPELE ELLAKLK
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPL48, a mitochondrial ribosomal protein, is part of the large subunit of the mitochondrial ribosome and plays a crucial role in mitochondrial protein synthesis. The study of MRPL48 is significant due to its potential impact on mitochondrial function and cellular metabolism, as mitochondria are vital for energy production and regulation of cellular apoptosis. Dysfunction in mitochondrial proteins, including MRPL48, has been implicated in various metabolic disorders and degenerative diseases, such as cancer, neurodegenerative disorders, and myopathies. Recent research has revealed that alterations in MRPL48 expression or function can lead to mitochondrial dysfunction, highlighting its role in maintaining mitochondrial integrity and overall cellular homeostasis. Understanding the structure, function, and regulation of MRPL48 may provide insights into the molecular mechanisms underlying mitochondrial-related diseases, and could pave the way for the development of therapeutic strategies aimed at restoring proper mitochondrial function. Additionally, studying the interactions of MRPL48 with other mitochondrial components can enhance our knowledge of ribosome biogenesis and protein synthesis within mitochondria, which is crucial for the proper expression of mitochondrial genes encoded by both nuclear and mitochondrial DNA. This comprehensive understanding is essential for revealing how MRPL48 and its associated pathways may be targeted in the management of various diseases linked to mitochondrial dysfunction.
