Analytical Data
-
Gene name
LCE1E
- Application
-
Alternative Names
LCE1E; LEP5Late cornified envelope protein 1E; Late envelope protein 5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T753
-
Expression Region
1-118aa
-
AA Sequence
MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRHHRSHRHRPQSSDCCSQPSGGSSCCGGGSGQHSGGCC
-
Molecular Weight
13 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LCE1E, a member of the Late Cornified Envelope (LCE) family, has garnered attention in dermatological and biochemical research due to its significant role in skin barrier function and differentiation. The LCE gene family is predominantly expressed in the epidermis and is implicated in the formation of the cornified envelope, a crucial component of the skin's protective outer layer. Disruptions in LCE gene expression have been linked to various skin disorders, including atopic dermatitis, psoriasis, and other inflammatory conditions, which highlights the potential of LCE1E as a biomarker for skin health. Recent studies have focused on the recombinant expression of LCE1E to elucidate its functional mechanisms and interactions within the skin barrier. By utilizing advanced molecular biology techniques, researchers aim to characterize the protein's structure, post-translational modifications, and its role in keratinocyte differentiation. Understanding the function of LCE1E may lead to novel therapeutic strategies for skin disorders, as enhancing its expression or mimicking its activity could improve skin barrier integrity and overall health. Furthermore, insights gained from LCE1E research could contribute to the development of more effective topical treatments or preventive measures for skin diseases associated with compromised barrier function. Thus, ongoing investigations into the recombinant LCE1E protein hold promise for advancing the field of dermatology and improving patient outcomes.
