Analytical Data
-
Gene name
LCE1C
- Application
-
Alternative Names
LCE1C; LEP3Late cornified envelope protein 1C; Late envelope protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T751
-
Expression Region
1-118aa
-
AA Sequence
MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC
-
Molecular Weight
39.93 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LCE1C, a member of the late cornified envelope (LCE) family, is primarily expressed in the outer layers of the epidermis and plays a crucial role in skin barrier function and integrity. The LCE gene cluster is known for its contribution to keratinocyte differentiation and is thought to be involved in the skin's response to environmental stressors. Mutations and variations in the LCE1C gene have been associated with various dermatological conditions, including psoriasis and atopic dermatitis, highlighting its significance in skin health. Recent studies have focused on the recombinant production of LCE1C to investigate its structural and functional properties, which aids in understanding its role in skin biology and-pathology. The recombinant protein serves as a valuable tool for exploring the molecular mechanisms underlying skin barrier dysfunction and provides a basis for potential therapeutic applications. By using techniques such as protein expression and purification methods, researchers aim to elucidate the interaction of LCE1C with other skin proteins and its role in cell signaling pathways. Furthermore, understanding the immunological aspects of LCE1C through recombinant approaches could lead to the development of novel biomarker strategies for diagnosing and monitoring skin diseases. Overall, ongoing research on LCE1C recombinant protein presents a promising avenue for advancing skin science and developing new therapeutic options for skin-related disorders.
